PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g021580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 766aa    MW: 83681.2 Da    PI: 5.732
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g021580.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-1962117156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R+++k
  Csa10g021580.1  62 KKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRELSLEPLQVKFWFQNKRTQMK 117
                     688999***********************************************998 PP

2START208.62.3e-652614801206
                     HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     ela +a++elv++a+ ++p+Wv      e++n++e+ ++f+++ +      ++ea+r+s+v +m++ +l e+l+d++ qW+  +     +a tle
  Csa10g021580.1 261 ELAVAAMEELVRMAQTGDPLWVPNDnsvEILNEEEYFRTFPRGIGpkpmgLRSEASRESTVFIMNHINLIEILMDVN-QWSSVFCgivsRALTLE 354
                     57899*****************877777**************999********************************.******99999****** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                     v+s+g      galq+m+ae+q++splvp R+ +fvRy++q+++g w++vdvS+ds ++ p    + R++++pSg+li++++ng+skvtwveh++
  Csa10g021580.1 355 VLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHSDGIWAVVDVSLDSLRPSP----ITRSRRRPSGCLIQELQNGYSKVTWVEHTE 445
                     ***********************************************************99....7***************************** PP

                     --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++r++h+++++lv++gla+gak+wvatl+rqce+
  Csa10g021580.1 446 VDDRSVHNMYKPLVNTGLAFGAKRWVATLDRQCER 480
                     *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-2243117IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1851119IPR009057Homeodomain-like
PROSITE profilePS5007117.00659119IPR001356Homeobox domain
SMARTSM003891.5E-1760123IPR001356Homeobox domain
CDDcd000862.66E-1862120No hitNo description
PfamPF000467.5E-1762117IPR001356Homeobox domain
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
PROSITE profilePS5084844.647252483IPR002913START domain
SuperFamilySSF559615.08E-35254482No hitNo description
CDDcd088759.17E-125256479No hitNo description
SMARTSM002345.7E-77261480IPR002913START domain
PfamPF018528.9E-55262480IPR002913START domain
Gene3DG3DSA:3.30.530.207.7E-6360479IPR023393START-like domain
SuperFamilySSF559615.17E-23501679No hitNo description
SuperFamilySSF559615.17E-23718757No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MYHPNMFESH HHMFDMTPKN SENDLGITGS QEDFETKSGA EVTMENPLEE ELQDPNQRPN  60
KKKRYHRHTQ RQIQELESFF KECPHPDDKQ RKELSRELSL EPLQVKFWFQ NKRTQMKAQH  120
ERHENQILKS ENDKLRADNN RYKDALSNAT CPNCGGPAAI GEMSFDEHHL RIENARLREE  180
IDRISAIAAK YVGKPLLANS SPFPQLTSSH HIPSRSLDLE VGNFGNNSNS QAGFVGEMYG  240
TSDILRSVSI PSEADKPMIV ELAVAAMEEL VRMAQTGDPL WVPNDNSVEI LNEEEYFRTF  300
PRGIGPKPMG LRSEASREST VFIMNHINLI EILMDVNQWS SVFCGIVSRA LTLEVLSTGV  360
AGNYNGALQV MTAEFQVPSP LVPTRENYFV RYCKQHSDGI WAVVDVSLDS LRPSPITRSR  420
RRPSGCLIQE LQNGYSKVTW VEHTEVDDRS VHNMYKPLVN TGLAFGAKRW VATLDRQCER  480
LASSMASNIP AGDLSVITSA EGRKSMLKLA ERMVMSFCSG VGASTAHAWT TLSTTGSDDV  540
RVMTRKSMDD PGRPPGIVLS AATSFWIPVA PKRVFDFLRD ENSRSEWDIL SNGGLVQEMA  600
HIANGRDPGN SVSLLRVNSG NSGQSNMLIL QESCTDASGS YVIYAPVDIM AMNVVLSGGD  660
PDYVALLPSG FAILPDGSAR VGGGSASTGA GGAGTEGGGG GEGNNLEVVT TTTGNNGGSL  720
LTVAFQILVD SVPTAKLSLG SVATVNSLIK CTVERIKAAL ACEGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299700.0AK229970.1 Arabidopsis thaliana mRNA for L1 specific homeobox gene ATML1/ovule-specific homeobox protein A20, complete cds, clone: RAFL22-43-B20.
GenBankAY0911040.0AY091104.1 Arabidopsis thaliana putative L1-specific homeobox gene ATML1/ovule-specific homeobox protein A20 (At4g21750) mRNA, complete cds.
GenBankAY1504910.0AY150491.1 Arabidopsis thaliana putative L1-specific homeobox gene ATML1/ovule-specific homeobox protein A20 (At4g21750) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010434132.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_010434133.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLR0GNC90.0R0GNC9_9BRAS; Uncharacterized protein
STRINGAT4G21750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein